SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001097002.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001097002.1.81976
Domain Number 1 Region: 905-931
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000262
Family Ran binding protein zinc finger-like 0.00097
Further Details:      
 
Domain Number 2 Region: 1010-1037
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000458
Family Ran binding protein zinc finger-like 0.0015
Further Details:      
 
Domain Number 3 Region: 1127-1153
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000196
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 4 Region: 1070-1095
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000288
Family Ran binding protein zinc finger-like 0.0013
Further Details:      
 
Domain Number 5 Region: 966-991
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000301
Family Ran binding protein zinc finger-like 0.0013
Further Details:      
 
Domain Number 6 Region: 1238-1265
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000011
Family Ran binding protein zinc finger-like 0.0034
Further Details:      
 
Weak hits

Sequence:  NP_001097002.1.81976
Domain Number - Region: 1663-1708
Classification Level Classification E-value
Superfamily Mannose-binding lectins 0.0196
Family Mannose-binding lectins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001097002.1.81976
Sequence length 1929
Comment nucleoporin 153kD, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEDAQEQRESSQAELAKKHPLTPLKELPEESEEEEEEEDESSAGALRESDSNNSIMGKMK
MRVSSILPASLSGWFSPSSKDGNDALSSPANLRQSQPRQSNGRLTTKRKRGRRRIMLAEV
DADAADDLDDGSDAKGLNYEEVALADNIAEHDLAAEDEQTRRSEYNVFLLRKRAGAVAAA
GGDEDEAEEDELEEDDEDGDEEDDDEEQENLQQSAAVQTKRRRLELETPVNLPNMRRLPL
LSSTPAAPLAAATSSSSSQMYKGVSHIAPHRRNHLNLYGSQRQREPAYNFFTGNEAAEGS
TGDLPHSIRRSLNIPFGGSSTATSYNNSLSSLPNHKRPSLIGKQTHRRDLTMDETGTGPA
MSSEEHLNHLLRISRTNNNTSNNNNNNNNNNNVIETKTRRSELSAAAGGCGDSQSESDMN
EYHDNGEGHDGLRPSHYNSNSNLEFYGNLQSSKSIFNRSNTAAQQSHRNSTWSLNSLTQR
RRFNASIYGSTSALSDSRLLSGSASNSGSASASSSPFYQGRTTFGGNSGNNRLFSRSNLS
SSAASSMLGLNSAGSSPAHQLHASMTGGIGYGMKAVDMRPSDSGSLAETSVGQGGSKKPG
TGLSNTTMRILNLLESYSTPLIDAKRMGSSIKEHQSSRQQRQGTPATPYLRSTSASRNVS
VPNHINELAELRSNKLLVPTMQQLLERRRLHRVTQNSRDVVHSQNVRAGGENNQEKPKPT
APYVAPIDQSANHTQHTNKMRSRLSHQTRNKETRTAEEEAPPPLDLPQISFPDMASAPKF
DLIIKPTVPVVSKPSTTDPIQSSKSSNTNLSTTNSKQMPNFLANPQPAAPIVNFAANGNV
SAISKPSKRTFTFSEPTPLSNFQENCIPKPKINRKYTFSAPAPLDDLRITNKQSQPTING
TPSSKEWECDTCMVRNKPEINKCVACETAKPVASAAPVQAPLPPSTAAIDTQSFVGFGDR
FKKSTTAWECDACMLSNKAEASKCIACETPRKTVAPKVNNFSPLITNAKSNEWECSVCLV
RNKVEVSKCVACESAKPGATMALPATSNIAVATPSIITDGFGDRFKKSATAWECDACMLS
NKAEASKCIACETPRKSSTPIANSSYPSINNNLPAGSGFDISFTRKANMWECQTCLVMNK
SSDEECIACQTPNSQARNSNSESALISSISSSSASFSGSLSRPSSRSSSGSTSTCGSVCS
GSIVSISSTTESAKALSAKKVPPKPDAGFQQLVAAQKTSTWECEACLAKNDMSRKTCICC
EQMMPEAFNPAATTANSAASSVPKFRFGFSHVKEVVKPSVETTTTPAPTSAQFSFGFGQS
NQGKDVADSKKTEAPKTFMFGVSKVEEPKTVSFGTGIKETTATSSTEATAPTPAAAAPAP
VQFVFKAPTTATTASSLTTTISTTSNAPALGGFSFGAPSSSSTVSSSTTSTSANPAAVKP
MFSWSGAGSAVSSTSSSQQPVAKAPTLGFGVSSSTVTTTTTSTKVFAFTPASGLDPAAAT
SAPAAGAGFSFGSQSKPATTQNTGTFFFGQPTAVAPATPTNPSVSSIFGAPATSTTASTS
VSATTSTSTANAIASSFAPTSTPQLFGNWGEKKTDLTTFGASSGSGTTTTPSFGWSSNGD
AAKSNSAAVGSAAVPSSSASTMATPIFGSSSMFGPSSSSNNTTSTSTTSLPFGSAATTAA
TTPAGGNAALTGLFGNVGNSLAGVGAPVATTPAATAAAPLTNIFGNPTPVAAAAPVFGSG
STIPSAGFGAPAAAAPLAAPALPGAFNFGGATAATPAASSAPFVFGSSTNEPLAKPSFNF
TGSAASSTAPAPAFNFTANTAATNNPSGGDSHPRIFQFGSSQPAANNQFGGAGGATNNSA
GGMPMFNFSPGAPQMQSTPNANALFQFSATSTAPANIFAFNPPAAGNSAQSSQTARRKIR
APVRRLPPR
Download sequence
Identical sequences A8JV18
FBpp0112385 FBpp0112385 7227.FBpp0112385 NP_001097002.1.81976 FBpp0074059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]