SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001097774.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001097774.1.81976
Domain Number 1 Region: 77-361
Classification Level Classification E-value
Superfamily L domain-like 1.47e-58
Family Ngr ectodomain-like 0.086
Further Details:      
 
Domain Number 2 Region: 269-358,443-606
Classification Level Classification E-value
Superfamily RNI-like 1.18e-42
Family Rna1p (RanGAP1), N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001097774.1.81976
Sequence length 620
Comment flyers-cup, isoform E [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MCGPYPRRRRYYQIREFQMASSADELESEDPDDELELDDSEPPTRAEDLPKRLYDINEAD
ADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVE
LPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFL
DGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDM
GLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDN
KITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPIKTIRRDILQCGT
TRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQMDDGDIPGNFPDRYKLRHTR
TLAVNLEELTSVPDQVFQIARDEGVHVVDFARNQLSTLPNGLQHMKDLVTELVLSNNVIG
YVPQFISQFTRISFLNLSNNLLNDLPTEFGVLNTLRELNIANNRFPCIPNCVYELQGLEI
LIASENHIKMLNVSGLQNMRRLSTLDLRNNDIETVPPILGNLTNITHLELVGNPFRQPRH
QILMKGTDAIMSYLRDRIPT
Download sequence
Identical sequences A8JQZ7
NP_001097774.1.81976 FBpp0111852 FBpp0111852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]