SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001097930.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001097930.1.81976
Domain Number 1 Region: 611-871
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.000000995
Further Details:      
 
Domain Number 2 Region: 510-602,871-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 230-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000995
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 434-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 311-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 6 Region: 355-391
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 190-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 397-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 9 Region: 275-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 481-517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001097930.1.81976
Sequence length 1063
Comment lipophorin receptor 2, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MATTCMPHFTEYFQTTTQSELTTNESANSRSSSSSSGCREPSKTSGFFYSASTHYQSKVQ
QLISFSFTSSFHLLFITCILSISKFCNAAAVNAAHVTAATPTASEIMHNLSGSALLERLK
ASTLGPTLDQLKHLAPAAANSISPGTGSGMGIGMGHFGSSINSVLNGNPLKFLNVSGKIG
TPLDISLGLSNYCDEKQFQCSTGECIPIRFVCDGSSDCPDHSDERLEECKFTESTCSQEQ
FRCGNGKCIPRRWVCDRENDCADGSDESTSQCRGLCSSLMFMCKNGEQCIHREFMCDGDQ
DCRDGSDELECGNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNF
FACKSGPCIPNQWVCDGDSDCRNGEDEMQNCTVSLLNFCQAGEFQCSDRITCLHKSWVCD
GEADCPDGEDESQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDCADGSDEIMCDISAT
PRTCNATTEFDCGGGLCIPNAKVCNRRKDCPNGEDEPAGKCGINECSSKNGGCMHQCVNL
EVGYRCECHDGYKLGADQHTCVDIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHT
RCKASEGHASLLLARRHDIRKIALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQS
IYKAPIDEGNDRTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK
DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQK
RLYWVDGKLNTISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANK
FNGMDVEPVTATHMLEHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRI
SCACPTGLKLMPDGLMCVEDLGIPTVRPTAPMHRTIEQSSNSTTKLPQDGYSETPVETKT
GNNRTDTSNQVHKSDAESENDYVEIALHVIASLAGTALVASVIYVVYRRCTRAVNSMNFE
NPVYHKTTEDHFSLEKNGTPHIYAAANDEEAVNPLFKSGTECV
Download sequence
Identical sequences A8JRC7
NP_001097930.1.81976 FBpp0112300 FBpp0112300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]