SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001098832.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001098832.1.59421
Domain Number 1 Region: 539-713
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-51
Family G proteins 0.0000188
Further Details:      
 
Domain Number 2 Region: 8-71
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000885
Family Calbindin D9K 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001098832.1.59421
Sequence length 740
Comment ras and EF-hand domain-containing protein [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MEADGDLEELARLRSVFAACDANRSGRLEREEFRALCAELRVRPADAEAVFQRLDADRDG
AITFQEFARGFRGARRVGPRRGWGPREPAPAAAQVGSDSGSGEEDEGDEDAAAALAAPWD
PASSGQAWQDFQARLGDEVKFIPRKEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIKLQ
STEMENLAIAVKRAQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYE
TEVGDLQVTIKKLKKLEEQSKHISQKQDVAALKKQIYDLSMENQKVKKDLLEAQTNIAFL
QSELDSLKSDYADQSLNSERDLEIIREYTEDRNSLERQIEILQTANRKLHDSNDGLRSAL
ENSCSKLSRALRINNISPGNTVSRSSPKFNLHSPQPLGYDRSSRSSYMDEDCDSLALCDP
MQRMNCDVDSLPESCFDSGLSTLRDSNEYDSEVEYKHQRGFQRSHGMQESFGGDASDTDV
PDIRDEETYGSEGVASILDWKPPGSASEGSIISSSRKPISALSPQTDMVDESHKSSSSQK
AYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKMLIVDGERTVLQLWDTAGQ
ERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWVDMIEDAAHESIPIMLVGNKADLRD
TAEAEGQKCVPGYFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDEDDSKSI
TNLSGTSSKKSTQMKNCCNG
Download sequence
Identical sequences A7Z031
ENSBTAP00000028993 ENSBTAP00000028993 9913.ENSBTAP00000028993 NP_001098832.1.59421 NP_001098832.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]