SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001099122.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001099122.1.59421
Domain Number 1 Region: 13-205
Classification Level Classification E-value
Superfamily Nudix 3.37e-30
Family MutT-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001099122.1.59421
Sequence length 222
Comment uridine diphosphate glucose pyrophosphatase [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MERIEGVAVGRCAASPYLVPLTLHYRQNGAQKSWDFMKTHDSVTILMFNSSRRSLVLVKQ
FRPAVYAGEVERLFPGSLAAAEQDRPQALQAALPGSAGVTYELCAGLLDQPGLSLEEVAC
KEAWEECGYRLAPSDLRRVTSYKSGVGLTGSSQTMFYAEVTDAQRGSPGGGLAEEGELIE
VVHLPLDGARTFADDPDVPKTLGVIFGISWFFSCVAPGLGLQ
Download sequence
Identical sequences Q05B60
NP_001099122.1.59421 NP_001099122.1.76553 ENSBTAP00000055697 ENSBTAP00000055697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]