SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001099883.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001099883.1.4139
Domain Number 1 Region: 6-100
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-19
Family Caspase recruitment domain, CARD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001099883.1.4139
Sequence length 1098
Comment caspase recruitment domain-containing protein 6 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MASEGASSEIIEKQRTKLLSVLQQDPDSILDTLTSRRLISEEEYETLEAITDPLKKSRKL
LILIQKKGEDSCCCFLKCLSNAFPQSASTLGLKQEVPRQGTGEVVEVSRGLEDPFSLGTI
TPEIAELSEEKECPGLGAPEFFTCKESSHREPEVPSWENQEGRGAQQVTAPRSVKGVEYE
VPASISLLSDGQRYEEPDDSLYLEEGEGEESLGYPEDVLEEGAGDDPQCFVYDSEEECEY
EENMGSSGEDSSCDDTSETCVPLEGEKSAEERKRVFQHVLSCLNMDRNRKLLPEFVRQFS
IDRGCEWTPKTPGDLAWNFLMKVQALDSTARDSILRPEVAGEENEELPAGIEKLGIGDPQ
TIHPLDVLCACMLCADSSLQREVMSNMYQCQFALPLLLPDAENNKNLLMVGAMKDLKQPS
AQSSGGPLRETDTFLGLTKMPVISFVRLGRCSFSKSRIVNTLLSSSQQKPYPIFLHQDLS
VPVLPRQISDGLVEVTWCFPDKLLKESPHAFQKPVAVANLRGDLESFWIQFGFLVEVSSG
LFFFTDCLGEKEWDLLMFLGEDTIERCYFILSPQAKESEEAQIFQRILKLKPSQLLFWEA
EEAGDRRKTMEALQAALQEVMSSPLRCVSLEEMASLARELGIQVDQDFEVTQDIQVSPTT
VEGENQQPCSQTKSPAESGAQEPIREPGAQCDDSQNAPVFHQTPVYMPYPAHPWPLPIKA
GGNFYHVPLNAPWVMGSHFGSQQRAKWFFPFPHQNTSVHSRGQNFSIKYFQPWRCYSRGR
FTNCSAKSQQNQNGPFGRSQRQTSHPENRQTSRTRQRSGTAASHVGHIHSSGSQATKATG
KPHSEKARAQGMQLTKAAGKSIRTQSHIKHPHPQPCQPAGAIQERIIPTSHQEAQRTTQG
RPSDLAFKPGSQSTSGNKHSSASQYNSHPPNFQSKHFQPKPFQPVPSHSQPSQAKPTHLN
PSPANYTHVQPSHAKPTHSKAFQANSHHPHPSHAKPTHLNPSHANPTHVQPSHAKPTHSN
LPKQNPPHPNLLSSRHTNLSSPSLSLLSRDPVSLNHPRPSLHRPGPPTQEQGDVKEHTLE
ICEIKYGLCLSYSSHIAV
Download sequence
Identical sequences D3ZVT3
ENSRNOP00000032723 10116.ENSRNOP00000032723 NP_001099883.1.100692 NP_001099883.1.4139 ENSRNOP00000032723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]