SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001100183.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001100183.1.100692
Domain Number 1 Region: 596-868
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-67
Family Kelch motif 0.0000805
Further Details:      
 
Domain Number 2 Region: 306-429
Classification Level Classification E-value
Superfamily POZ domain 1.02e-26
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001100183.1.100692
Sequence length 875
Comment kelch-like protein 29 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSRHHSRFERDYRVGWDRREWSVNGTHGATSVCSVTSGAGGGTASSLSARPGLLPLPVVP
SRLPTPATAPAPCTTGNSEAITSLVASSASAVTTKAPGISKADNQSQGLTTSIRWGQTPV
NQSTPWDTDEPPSKQMREGDNPGTGPWVTTVAAGNQPSLIAHSYGVAQPPTFSPAVNVQA
PVIGVTPSLPPHVGPQLPLMPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPG
VGQVARPGPTAVGNGHMAGPLLPPPPPAQPSAALPSSVPATNGPPTTDSAHGLQMLRTIG
VGKYEFTDPGHPKEMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR
SVQDGSQGSREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDF
IAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAAELLAAVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQR
SLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLL
DNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAV
HSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKYAPAVTLNGFV
FILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences D4AEF4
10116.ENSRNOP00000007160 ENSRNOP00000061351 NP_001100183.1.100692 NP_001100183.1.4139 XP_008762772.1.100692 XP_017449560.1.100692 XP_017449561.1.100692 ENSRNOP00000007160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]