SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001101336.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001101336.1.100692
Domain Number 1 Region: 306-408
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 44-149
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 417-531
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 
Domain Number 4 Region: 186-283
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001101336.1.100692
Sequence length 754
Comment lysyl oxidase homolog 3 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MRAVNVCYCCPWRLLLLHFLCSSSMGSPSPSTDPEKKVGSQGLRFRLAGFPRKPYEGRVE
IQRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCKGTEG
SVTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVDHQLQVEEVRLRPAVEWGR
RPLPVTEGLVEVRLPEGWSQVCDKGWSAHNSHVVCGMLGFPGEKRVNMAFYRMLAQKKQH
SFGLHSVACVGTEAHLSLCSLEFYRANDTTRCAGGSPAVVSCMLGPLYATSTGQKKQQHS
KPQGEASVRLKGGAHPGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGTAREALSG
ARMGQGMGAIHLSEVRCSGQEPSLWKCPSKNITAEDCSHSQDAAVRCNLPYTGVETKIRL
SGGRSRYEGRVEVQIGVPGHLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDS
GNVTEVVMSGVRCTGSELSLNQCAHHNTHVTCKRTGTRFTAGVICSETASDLLLHSALVQ
ETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRH
SWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGE
QGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDG
HRIWVHNCHIGDAFSEEANRRFERYPGQTSNQIV
Download sequence
Identical sequences D3ZP82
10116.ENSRNOP00000010293 NP_001101336.1.100692 NP_001101336.1.4139 ENSRNOP00000010293 ENSRNOP00000062815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]