SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001101555.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001101555.1.4139
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-23
Family Caspase recruitment domain, CARD 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001101555.1.4139
Sequence length 165
Comment death domain-containing protein CRADD [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MDARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEATAELPTAQPRKDHLPEKPFIIRLITAA
PREAAPESLSPVAETAQSGQKGRLDQSNSCPSAPVAATEACLDQS
Download sequence
Identical sequences D3ZB14
ENSRNOP00000062865 ENSRNOP00000011424 10116.ENSRNOP00000062865 NP_001101555.1.100692 NP_001101555.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]