SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001101714.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001101714.1.4139
Domain Number 1 Region: 429-713
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-83
Family Kelch motif 0.0000014
Further Details:      
 
Domain Number 2 Region: 158-276
Classification Level Classification E-value
Superfamily POZ domain 1.78e-31
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001101714.1.4139
Sequence length 717
Comment kelch-like protein 4 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPSQGSPNTGSCLQQEGYEHRGTPVQGRLKNHSRDRN
GLKKSNSPVHHDILTPVPGPAPTHQRVLQNWHQQNVIVHLQANEDTPKAVPEGNLLKEAC
EKRARDLEMMGDDNIEDSRARQYAEEPEQMNVISEDHYRSRNHADYTLCKMESYLKEKKL
CDVLLIAGPLKIPAHRLVLSAVSDYFAAMFTNDVLEARQEEVKMEGVDPNALNSLVQYAY
TGVLQLREDTIENLLSAACLLQLTQVIDVCCNFLIKQLHPSNCLGIRSFGDAQGCMELQN
VAHKYTMEHFIDVVKNQEFLLLPANEISKLLCSDDINVPDEETIFHALMQWVGHDAQARQ
QDLAKLLSYIRLPLLSPQLLADLENSSMFSGDLECQKLLMEAMKYHLLPERRSMLQSPRT
KPRKSTVGALYAVGGMDAAKGTTTIEKYDLRTNSWIHIGTMSGRRLQFGVAVVDNKLYVV
GGRDGLKTLNTVECFNPVTKTWVVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVE
RWDPDGRQWNYVASMSTPRSTVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCA
PMSKRRGGVGVATHNGYLYVVGGHDAPAPNHCSRLSDCVERYDPKSDSWSTVAPLSVPRD
AVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQKDEWKEEVPVNIGRAGACVVVVKLH
Download sequence
Identical sequences ENSRNOP00000006992 10116.ENSRNOP00000006992 NP_001101714.1.100692 NP_001101714.1.4139 ENSRNOP00000006992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]