SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001101954.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001101954.1.100692
Domain Number 1 Region: 321-394
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000135
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 119-194
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000137
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 956-1045
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000353
Family Carboxypeptidase regulatory domain 0.02
Further Details:      
 
Domain Number 4 Region: 875-947
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000745
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  NP_001101954.1.100692
Domain Number - Region: 434-490
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.002
Family Carboxypeptidase regulatory domain 0.033
Further Details:      
 
Domain Number - Region: 207-291
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00392
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 802-861
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00549
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 43-108
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00628
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001101954.1.100692
Sequence length 1214
Comment nodal modulator 1 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MRAGRCAAVLLLLLLSGPGRAIGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQ
TDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTNVELHVDGVSDVCTRGGDINFVFTG
FSVNGKVLSKGQPLGPAGVQVSLRSTGADSKIQSTVTQPGGKFAFFKVLPGDYEILATHP
TWALKEASTTVRVTNSNANAAGPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVNKEDVL
GCNVSPVSGFQPPDESLVYLCYAVSKEDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSR
LDFTVEHDSLRIEPVFHVMGFSVTGRVLNGPDGEGVPEAVVTLNNQIKVRTKADGSFRLE
NITTGTYTIHAQKEHLYFDMVTIKIAPNTPQLADLIATGFSICGQISIIRSPDTIKQMNK
YKVVLSSQDKDKALVTVETDAHGSFCFKAKPGIYKVQVVVPEAETRAGLMLKPQTFPITV
TNKPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFD
KVLPGKYKISIMHEDWCWRNKSLEVEVLEDDVSAVEFRQTGYMLRCALSHAITLEFHQDG
NGPENVGIYNLSRGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHV
LGTIITDKMMDVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIETRRQEREKNGKEE
GEEGRARPPGQEMVDELQGPFSYDFSYWARCGEKITVTPSSKELLFYPPSMEATVSGESC
PGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLE
YTVTSQKEGFVLTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLT
QDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLRITITGFRTAYSCYGTVS
SLNGEPEQGVAVEAVGQKDCSIYGEDTVTDEEGKFRLRGLLPGCMYHVQLKAEGNDHIER
ALPHHRVIEVGNNDVDDVNIIVFRQINQFDLSGNVITSSEYLSTLWVKLYKSESLDNPIQ
TVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYVLPQVSFAAVGYHKHITLVFSPT
RKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDSSGPE
DMKRQTKKQKTRRT
Download sequence
Identical sequences D3ZSA9
ENSRNOP00000028680 ENSRNOP00000028680 10116.ENSRNOP00000028680 NP_001101954.1.100692 NP_001101954.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]