SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001103205.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001103205.1.45394
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-24
Family HtrA-like serine proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.73e-23
Family Prokaryotic proteases 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001103205.1.45394
Sequence length 200
Comment serine protease HTRA2, mitochondrial-like [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLTNLDGEVIG
INTMKVTAGISFAIPSGRVRLFLDRSADKQKSWFGESGSKRRYIGVMMLTLTPSIIKELR
MRDLSFPDVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVRTSESLN
VVVRRGADLLMLHMTPESTE
Download sequence
Identical sequences A7MC75
gi|163916178|gb|AAI57579| gi|166158059|ref|NP_001107438| NP_001103205.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]