SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001103565.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001103565.1.59421
Domain Number 1 Region: 97-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-20
Family Classic zinc finger, C2H2 0.000069
Further Details:      
 
Domain Number 2 Region: 662-728
Classification Level Classification E-value
Superfamily Homeodomain-like 3.51e-16
Family Homeodomain 0.0012
Further Details:      
 
Domain Number 3 Region: 60-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000149
Family Classic zinc finger, C2H2 0.00036
Further Details:      
 
Domain Number 4 Region: 466-533
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000235
Family Homeodomain 0.0037
Further Details:      
 
Domain Number 5 Region: 567-629
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000248
Family Homeodomain 0.0000586
Further Details:      
 
Domain Number 6 Region: 298-350
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000012
Family Homeodomain 0.012
Further Details:      
 
Domain Number 7 Region: 781-825
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000642
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001103565.1.59421
Sequence length 873
Comment zinc fingers and homeoboxes protein 1 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MASRRKSTTPCMVLASEQDPDLELVSDLDEGPPVLTPIENTRTESVSSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENSEQAESTEVSSSGISISK
TPIMKMMKNKVENKRITVHRNSAEDIPEEKENEIKPDREETVENPSSSASESNASTSVVN
RIHPHAASTVVAPAAVLPGLAQVITAVSAQQNSSLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISAGSNGLPSILQTCQIVGQPGLVLTQVGGTNTLPVTAPIALTVAGV
PNQTNVQKSQVPTTQPTTETKPAIAAVPSAQLVKHEATLANPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDAEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSATIII
DSSDETTESPAVVTSQQKQSWNPFPDFTPQKFKEKTAEQLRALQASFLNSSVLTEEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKVEVEESNAGSSKEEAGETSPGDETSAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGGKRMNNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEEEEETDDSDTWEPPRHVKRKLSKSDD
Download sequence
Identical sequences A8KC64
ENSBTAP00000020381 NP_001103565.1.59421 NP_001103565.1.76553 9913.ENSBTAP00000020381 ENSBTAP00000020381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]