SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001103991.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001103991.1.45394
Domain Number 1 Region: 49-110,143-198
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 196-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000439
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  NP_001103991.1.45394
Domain Number - Region: 237-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001103991.1.45394
Sequence length 397
Comment uncharacterized protein LOC563864 precursor [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MLGICLCLSVAVHFAVSQEAEAQEPVTYTASRPTFDEHDIYERELWELFDCLCTEGYEFD
FEKQICKDIDECKTVLEACKGGMKCINHFGGYLCLPHNARIIVSNGEGEPTTAPPVERFQ
PVIPQISRGEFSRVIQSSSHSIQCGVGFMADSQNYCRDVNECLTANPCQHQCYNLMGSYI
CQCEVGFELASDSVSCQDINECEISNYICQFQCVNEPGAFHCACPEGYQLQGPRMCQDID
ECETGAHNCREDEMCWNYYGGFRCYPRDPCREPYVKTGEGRCRCQSQTVCRGLPPVIVYK
YMSIFSDRSVPADIFQIQATSVYPNMVNTFTIKNGNEGGEFYLRRSSNVSAMLVMTKPLT
GPREHVVDLEMVTQSNVLSYRSSSLLRLTIVVGPYPF
Download sequence
Identical sequences A0A0R4IL08
ENSDARP00000101038 NP_001103991.1.45394 ENSDARP00000101038 7955.ENSDARP00000101038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]