SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001104480.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001104480.2.81976
Domain Number 1 Region: 22-551
Classification Level Classification E-value
Superfamily TPR-like 1.4e-151
Family HAT/Suf repeat 0.00000000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001104480.2.81976
Sequence length 733
Comment suppressor of forked, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSSARDLIKVDIEWGMERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVN
VFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHK
EKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTP
IVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPP
TLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQ
FLDTSARVLTEKGDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKV
HTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALME
YYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPH
KSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCT
STELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAH
PGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDN
ELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLPGGDDSDDELQTAVPPSHDI
YRLRQLKRFAKSN
Download sequence
Identical sequences FBpp0112456 FBpp0297503 NP_001104479.1.81976 NP_001104480.2.81976 FBpp0112456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]