SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001106797.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001106797.1.92730
Domain Number 1 Region: 354-457
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001106797.1.92730
Sequence length 458
Comment macrophage scavenger receptor types I and II isoform b [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTKEMTENQRLCPHEQEDADCSSESVKFDARSMTASLPHSTKNGPSLQEKLKSFKAALIA
LYLLVFAVLIPVVGIVTAQLLNWEMKNCLVCSLNTSDTSQGPMEKENTSKVEMRFTIIME
HMKDMEERIESISNSKADLIDTERFQNFSMATDQRLNDILLQLNSLISSVQEHGNSLDAI
SKSLQSLNMTLLDVQLHTETLNVRVRESTAKQQEDISKLEERVYKVSAEVQSVKEEQAHV
EQEVKQEVRVLNNITNDLRLKDWEHSQTLKNITFIQGPPGPQGEKGDRGLTGQTGPPGAP
GIRGIPGVKGDRGQIGFPGGRGNPGAPGKPGRSGSPGPKGQKGEKGSVGGSTPLKTVRLV
GGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIW
LNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Download sequence
Identical sequences P30204
NP_001106797.1.92730 ENSMUSP00000026021 ENSMUSP00000026021 ENSMUSP00000026021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]