SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001106805.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001106805.1.4139
Domain Number 1 Region: 265-617
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.82e-126
Family PDEase 0.000000000012
Further Details:      
 
Weak hits

Sequence:  NP_001106805.1.4139
Domain Number - Region: 152-222
Classification Level Classification E-value
Superfamily Hyaluronidase post-catalytic domain-like 0.0523
Family Hyaluronidase post-catalytic domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001106805.1.4139
Sequence length 686
Comment cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform 4 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAFVWDPLGVTVPGPSPRTRTRLRFSKSYSFDVDNGTSAGRSPLDPMTSPGSGLILQANF
VHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAA
LTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSE
MASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKRPMS
QISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTV
IMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPA
LEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL
LQEENCDIFQNLTKKQRQSLRKMAIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLL
DNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDK
HNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDD
QEDGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDE
QVEEEAVAEEESQPQTGVADDCCPDT
Download sequence
Identical sequences NP_001106805.1.100692 NP_001106805.1.4139 ENSRNOP00000063446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]