SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001107291.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001107291.1.99540
Domain Number 1 Region: 112-518
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-84
Family L-arabinose binding protein-like 0.00079
Further Details:      
 
Weak hits

Sequence:  NP_001107291.1.99540
Domain Number - Region: 33-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000115
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001107291.1.99540
Sequence length 924
Comment gamma-aminobutyric acid type B receptor subunit 1 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MCRSITLLFALWLTPVFGSGQSNTTGCRIIHPPRDGGIRYRGLTLTQVKAVEVLPVDYEI
EFVCRGEREISGPKVRKCQRNGTWTDMDKPSRCFRRPDTSIRHPESSRKRALHVGALFPM
SGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPI
KIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRV
QLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLKRQD
ARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQA
VEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIWALA
LALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTL
IEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVL
AGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDGRHIETWH
FPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYTTVS
LLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYG
SKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFA
FSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLEREN
QELGRIIAEKEERVMELRQQLRSRRRPSVPARDNCSDNHFPNSSGAVSSLYQPGLPLARC
LVAEGGDKLGRNSCDGSRVHLLYK
Download sequence
Identical sequences A9JRJ5
NP_001107291.1.99540 gi|161611455|gb|AAI55686| gi|166158180|ref|NP_001107291|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]