SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001108628.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001108628.1.87134
Domain Number 1 Region: 1-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-45
Family GDI-like N domain 0.00000000318
Further Details:      
 
Domain Number 2 Region: 344-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.19e-16
Family GDI-like N domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001108628.1.87134
Sequence length 400
Comment rab GDP dissociation inhibitor beta isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKK
TTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYL
YPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPS
YVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAA
QGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYD
ATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences A0A2I3GUC1
gi|169646441|ref|NP_001108628.1| NP_001108628.1.87134 NP_001108628.1.92137 XP_003257652.1.23891 ENSP00000369528 ENSP00000369528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]