SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001116936.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001116936.1.99540
Domain Number 1 Region: 151-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-100
Family Protein kinases, catalytic subunit 0.0000000000298
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-24
Family Pleckstrin-homology domain (PH domain) 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001116936.1.99540
Sequence length 485
Comment RAC-beta serine/threonine-protein kinase [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHSSIPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVAEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKSSGR
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFASINWQD
VTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSYS
ASIRE
Download sequence
Identical sequences B1WB72
8364.ENSXETP00000037022 ENSXETP00000037022 gi|171846406|gb|AAI61640| gi|183986695|ref|NP_001116936| ENSXETP00000037022 NP_001116936.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]