SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001123798.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123798.1.99540
Domain Number 1 Region: 933-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 887-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000019
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 349-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 4 Region: 993-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 5 Region: 1042-1094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number 6 Region: 285-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000565
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 7 Region: 839-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 472-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1150-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1639-1843
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000105
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number 11 Region: 425-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 12 Region: 1198-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1094-1147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 14 Region: 524-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  NP_001123798.1.99540
Domain Number - Region: 106-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0017
Family N-terminal domain of xrcc1 0.067
Further Details:      
 
Domain Number - Region: 1507-1580
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001123798.1.99540
Sequence length 1853
Comment uncharacterized protein LOC100170549 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MELWEATGLQRTLWESIRAKKFLLIFYLVIGQILGSLAQEPDVLHHGCTEGGCYPATGNL
LIGRAQSLSATSTCGMEEAQEYCIVSHLQDSEKCFACDSRVPYQKESHRIENVIYLTEED
EEKTWWQSENGVESVSIRLDLEAEFHFTHLIMKFKTFRPAAMLIERSADYGRTWKVYRYF
SYNCTKMFPGVPIHALQQIDDIICDQRYSDIEPSSEGEVIYKVLDPAITVEDPYSAEIQE
LLQITNLRINFTKLHTLGDNLLDQRPEVLQKYYYSVYELVVRGSCFCYGHASECSPVEGI
EAGVEGMIHGRCVCKHHTKGLNCEQCQDFYHDLPWRPAEANDPHTCKRCNCNNHSRKCHF
DMAVYLATGKESGGVCDDCQHNTMGRNCELCKPFYYQDPRADIRADNACISCDCDPVGSL
DGGVCDSHTNVNLGMIAGQCRCKGNVKGERCDSCKESFYGLSMNDPVGCQPCSCDPRGII
TGNTPCDQISGDCYCKRFVTGRYCNQCLPEYWGLSNDITGCRPCDCDFGGAYNNKCSLGD
GQCDCRSNIIGRQCGDVQLGYFCMPLDYYTYEAENAKGLSPTDPQLPGSPKPEAQTDCLE
YFNGIQNGKKVRLRRQRRTARVLQQRASQRRARQLQQKPDTEVIRREHNSGHMVTWTGQG
FVRVRDGAGLLFQIDNVPYPMDYDIMIRYEPESAEDWEATVSVTSRILPMSPRCGNVLPS
EQMYKEKLPHTERYLVLPKPFCFESNNQYEISIRFQRWGAANRHPAAFILIDSLVLLPKI
YELPGFHGNDPVSVHHREEMERYMCLDSFKMATMPDLAEMCIKLLCSISAIIHDGALPCL
CDLQGSLSAVCDKIGGQCKCKPNVIGQRCDQCAPGTYGFGPYGCSKCDCHPQGSTSRLCN
PFTGQCPCQSNVAGRQCDQCLPGQWGYPHCRPCVCNGHSDECDSKTGACIRCRDSTTGRH
CEKCLDGYYGDPILGSGQQCRPCPCPGYPGSRNYHGSSCYADKDSHQIVCLCAPGYTGTR
CDRCSPGYFGNPEQEGGECRPCQCNNNIDPTDPESCDSHSGMCMKCLYNTDGAHCEECKA
GFYGSAMQRNCRRCTCNEQGTLQSHCTRDVCYCDRVTGHCPCRANVLGKSCDQCASNFWN
FGGDLGCEPCTCDPAHSLRQDCNVFTGQCHCQPGFGGRVCSHCQENYWGDPQIKCEVCDC
DAYGSETAQCDPLTGKCFCRKGFTGQRCDQCARGFQNNYPRCLPCHECFAQWDMIISQLR
DRLQGVQQKLLDFQEGAVAPEISHSQIKELDNKLRTIEELIKDGGADGMRMLEQMTKLVN
KISSEVAQLSFQLHTQEKQMNGTEAKDRWQRGKLDQLTLDITVVNETVYDLKVQIEAIVA
AGFNESYNSIVKSYLESTEAEKIANGSVYGPGSPVFQSQQTREETERLLKEKLDTYKRNM
TAQKSSLKELQKKVQGLNVSKINEKICGAPGDQECEDSPCGGANCRDEDGKRKCGGDDCN
GALPVSAKALSTAQNITLELENMANRLKDIAQKIQDIQGIAQDAKVQTEATLANAKESKR
RIEDSTEKLREFIKKIKDFLTEEGADPESIELVARQVLNISLPASPGDIEALVNKIKESI
GNLSCTDEILTNTSEILATAKNLHKEAVEAQAKAEAVSANISDAQALLQEAEAKAKSAEK
ALKKAKQSIKDVKSKVEQTMQTLTGVEQKEMDIMERIGNLSEKVDDLLDKTESNRQIASD
AKERANLVLNSTGELRKEMDDVQRKYDDLKEKVGGYNSSSGTALDRIEKIKEEAKALYDK
ANTAKKELAKLEAQFRANEANMTAKILTIEQLENQTTQLLNDIREKSNIYSTC
Download sequence
Identical sequences B3DLV1
NP_001123798.1.99540 gi|189441913|gb|AAI67592| gi|194332619|ref|NP_001123798|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]