SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001123933.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123933.1.37143
Domain Number 1 Region: 77-219
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-22
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001123933.1.37143
Sequence length 221
Comment toll/interleukin-1 receptor domain-containing adapter protein [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Download sequence
Identical sequences A0A024R3M4 B3Y685 B3Y686 P58753
NP_001034750.1.87134 NP_001034750.1.92137 NP_001123933.1.37143 NP_001266132.1.60992 NP_001305706.1.87134 NP_001305706.1.92137 XP_011540878.1.92137 XP_014202482.1.60992 XP_016775348.1.37143 XP_016775349.1.37143 XP_016872651.1.92137 ENSP00000376446 ENSP00000376447 ENSP00000436967 ENSPTRP00000007613 ENSP00000376446 ENSP00000376447 ENSP00000436967 ENSPTRP00000007613 gi|89111122|ref|NP_001034750.1| HR3124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]