SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001123940.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123940.1.37143
Domain Number 1 Region: 635-783
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-46
Family Toll/Interleukin receptor TIR domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 331-583
Classification Level Classification E-value
Superfamily L domain-like 2.44e-33
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 3 Region: 35-205,346-415
Classification Level Classification E-value
Superfamily L domain-like 1.53e-21
Family Ngr ectodomain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001123940.1.37143
Sequence length 796
Comment toll-like receptor 6 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MTKDKEPIVKSFHFVCLMIIIVGTRIHFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELKVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGPTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIHEEEFTYS
KTTLKALKIEHITNKVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVIKLKALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELRQF
VKSIDQVSSEVLEGWPDSYKCDYPESYRGTPLKDFHMSELSCNITLLIITIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKTEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMMQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS
Download sequence
Identical sequences B3Y641 D7NVM5
ENSPTRP00000027517 NP_001123940.1.37143 XP_009445762.1.37143 XP_009445763.1.37143 ENSPTRP00000027517 9598.ENSPTRP00000027517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]