SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001124181.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001124181.1.92137
Domain Number 1 Region: 126-291
Classification Level Classification E-value
Superfamily RUN domain-like 5.62e-54
Family RUN domain 0.000000026
Further Details:      
 
Weak hits

Sequence:  NP_001124181.1.92137
Domain Number - Region: 331-378
Classification Level Classification E-value
Superfamily Prefoldin 0.00126
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001124181.1.92137
Sequence length 506
Comment protein RUFY3 isoform 3 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAETPPPPTAGAESCSEEPARGGEWRPEEPRRAPAGGTDREGEAGPPPASPAGQSEPDSP
VAAPFFLLYPGDGGAGFGVRPPPQQQRSWRTPPSPGSPLPFLLLSYPSGGGGSSGSGKHH
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQR
Download sequence
Identical sequences ENSP00000399771 NP_001124181.1.87134 NP_001124181.1.92137 gi|195220720|ref|NP_001124181.1| ENSP00000399771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]