SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001124463.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001124463.1.92137
Domain Number 1 Region: 35-216
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.91e-45
Family Actin/HSP70 0.00017
Further Details:      
 
Domain Number 2 Region: 226-426
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.28e-41
Family Actin/HSP70 0.0000482
Further Details:      
 
Domain Number 3 Region: 739-819
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.000000000000647
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001124463.1.92137
Sequence length 999
Comment hypoxia up-regulated protein 1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Download sequence
Identical sequences Q9Y4L1
ENSP00000384144 ENSP00000458419 ENSP00000480150 9606.ENSP00000278752 ENSP00000384144 ENSP00000458419 NP_001124463.1.87134 NP_001124463.1.92137 NP_006380.1.87134 NP_006380.1.92137 XP_016872585.1.92137 XP_016872586.1.92137 gi|195976805|ref|NP_001124463.1| gi|5453832|ref|NP_006380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]