SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001128202.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001128202.1.100692
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001128202.1.100692
Sequence length 172
Comment galectin-related protein [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAGSVADSDAVVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences A0A2K5UYR9 B4F7A3 E1BKC9 F6QMT0 I3L8J2 I3N9X9 Q8VED9
ENSSTOP00000021176 10090.ENSMUSP00000044342 10116.ENSRNOP00000008274 9913.ENSBTAP00000000179 ENSMUSP00000044342 ENSMUSP00000044342 ENSSSCP00000020352 NP_001128202.1.100692 NP_001128202.1.4139 NP_001192760.1.59421 NP_001192760.1.76553 NP_776113.1.92730 XP_003481250.1.46622 XP_004280678.1.21590 XP_004435681.1.5094 XP_005322124.1.77405 XP_005366514.1.66349 XP_005575805.1.63531 XP_006079873.1.26621 XP_007464176.1.90284 XP_011981169.1.54773 XP_013370195.1.28644 XP_014444699.1.99106 XP_015335094.1.40921 XP_017910910.1.57651 XP_019798449.1.83887 XP_020771882.1.74333 XP_021066521.1.100879 XP_021504140.1.76796 ENSTTRP00000007554 ENSSTOP00000021176 ENSTTRP00000007554 ENSRNOP00000008274 ENSBTAP00000000179 ENSMUSP00000044342 GO.49308 mmt010014306.1 ENSBTAP00000000179 ENSSSCP00000020352 ENSRNOP00000008274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]