SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001129549.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001129549.1.92730
Domain Number 1 Region: 149-323,376-569
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.93e-92
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 646-912
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-36
Family DNA/RNA non-specific endonuclease 0.0085
Further Details:      
 
Domain Number 3 Region: 56-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000301
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000288
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001129549.1.92730
Sequence length 914
Comment ectonucleotide pyrophosphatase/phosphodiesterase family member 2 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MARQGCFGSYQVISLFTFAIGVNLCLGFTASRIKRAEWDEGPPTVLSDSPWTNTSGSCKG
RCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCS
EDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKK
GSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAT
FHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVSIPHERRILTILQWLSLPDNERP
SVYAFYSEQPDFSGHKYGPFGPEESSYGSPLTPAKRPKRKVAPKRRQERPVAPPKKRRRK
LHRMDHYTAETRQDKMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDR
TEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPYMKQHL
PKRLHYANNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFV
GYGPTFKYRTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVS
RPNYPGIMYLQSDFDLGCTCDDKVEPKNKLEELNKRLHTKGSTEERHLLYGRPAVLYRTS
YDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLA
YKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERN
GVNVISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPL
SVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRKTSRSYSEI
LTLKTYLHTYESEI
Download sequence
Identical sequences ENSMUSP00000128941 ENSMUSP00000128941 NP_001129549.1.92730 ENSMUSP00000128941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]