SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001129836.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001129836.1.50509
Domain Number 1 Region: 130-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.000052
Further Details:      
 
Domain Number 2 Region: 201-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-24
Family Nuclear receptor ligand-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001129836.1.50509
Sequence length 483
Comment Nuclear Hormone Receptor family [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MNASITHIKSELDPTMQAFQMPHNDLFLATAAPHYNPFALSNDFMPNPLMPSFTSPFYPQ
HFPVSDSRRGSQGTTSSSNNTGGTPSPHSSSLPTSPPQLQGFLRSFLNPDNLSTPTSFGV
PSETALDADKMCAVCNDRAVCLHYGARTCEGCKGFFKRTVQKNSKYTCAGNKTCPIDKRY
RSRCQYCRYQKCLEVGMVKEIVRHGSLSGRRGRLSSKTKLARSEDQPSPPLPLLALMGKA
IEDHTNMTVVRQFMQPFDETIALRILHGELHATKKLLMAMPQISEIQPADFQILLSRSFF
AIMAIRVANRCGNSTDTIMFESGELFSLNAFPACFQQIIRFMVDKARTFSSLVDWEPQAF
AAFIALQFLAGNTEHNVLGLTNKPLVDQVQSTIINALKDHCSGSQNKLAKIVRLTQEFDV
FHALGLQALDILYPSHQLPEEFMFLINLTRAPLRSTDAPPACGSPVAPSGSSLFNFQMGP
AAF
Download sequence
Identical sequences B2MZB4
C48D5.1b C48D5.1b.1 C48D5.1b.2 NP_001129836.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]