SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001135711.2.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001135711.2.99540
Domain Number 1 Region: 45-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000156
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001135711.2.99540
Sequence length 138
Comment epigen precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
malqiilltltsaamivlgeeysvtkspeltskikeqaqefiednpcskeylnyclnghc
vfhadlttplcrcdsgftgercehmtlstyspdeeavyiaigigvgllisgvivfiwyyw
kkrckktnyetckkteei
Download sequence
Identical sequences A0A1B8Y8M1
NP_001135711.2.99540 gi|348041401|ref|NP_001135711|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]