SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001137581.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001137581.1.59421
Domain Number 1 Region: 1208-1363,1402-1481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1531-1781
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 760-907,941-988
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 128-273,363-432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  NP_001137581.1.59421
Domain Number - Region: 1790-1834
Classification Level Classification E-value
Superfamily EF-hand 0.00815
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001137581.1.59421
Sequence length 2006
Comment sodium channel protein type 2 subunit alpha [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDESGPKPNSDLEAGK
SLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFELNITSFFNNSL
DGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESREFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKEDGVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
SALTSPAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTARQRAMSMASILTNTMEELE
ESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGLIVSLSLMELG
LANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKR
KIREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIG
SSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATS
SSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRK
TCYKIVEHNWFETFIVFMILVSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLL
KWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSR
FEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSV
VNNYSECKALIDSNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVEL
QPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYN
AMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM
TNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYF
VSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGM
SNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPG
SSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFY
EVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILF
AFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRY
LLKQKVKKVSCIYKKDKGKEGEGTPIKEDILIDKLNENSTPEKTDMTPSTTSPPSYDSVT
KPEKEKFEKDKSEKEDKGKDIRESKK
Download sequence
Identical sequences E1BMH1
NP_001137581.1.59421 NP_001137581.1.76553 XP_010800314.1.76553 XP_019827273.1.53367 ENSBTAP00000053208 ENSBTAP00000053208 9913.ENSBTAP00000053208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]