SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001137723.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001137723.2.81976
Domain Number 1 Region: 49-431
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1190-1264
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000228
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001137723.2.81976
Sequence length 1500
Comment uncharacterized protein Dmel_CG42672, isoform J [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFKSRLKTNPGGSENINRFGDSMGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDEN
ATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEV
EHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLV
QRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTD
CVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAV
KAGHRTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDT
PLLRAVRNRNLEIVHLLLDRKAKVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLL
YRANKAGETPYNIDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLT
TPITVGLYAKWGSGKSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVG
LSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVA
FCHPPGPQSDSQAKPVRFHFAEANSASPTGDGAVAHMLAALLDAIESHYGWLATRLYRAF
RPKCLKVDVGWRWRRMCCIPIVLIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYV
IAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCL
DAFTNQQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEA
NSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPT
LGHSVSARRLSNASEIISSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVL
DLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRA
SMIVLHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKS
DLLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYV
PSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEG
VISLLDRIEDMKPALPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITT
LRECERLPRKQQRQQQQPGALEAPSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTL
EEQMICGTLQTLNEEAYEDVASSERPSPTELDTPSAGAAMTTPLLGASGSVPAPSGRESI
LKQQGSVKADKRVSIQQMATSNNNNNNSTKLTPNVEYVSERQPEVQGAGKRLTTKPPPGP
RPASLIITRNDSNSQFQLLRSSSVDYDDVEAQEHRTTIRTTLLEQQEEEESAPFVFTVRK
Download sequence
Identical sequences B7YZM3
FBpp0291846 FBpp0291846 NP_001137723.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]