SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001137821.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001137821.1.81976
Domain Number 1 Region: 878-979
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.65e-34
Family MBT repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 792-918
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.9e-32
Family MBT repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 559-675
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.88e-26
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 656-756
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-26
Family MBT repeat 0.00074
Further Details:      
 
Domain Number 5 Region: 1160-1228
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000479
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001137821.1.81976
Sequence length 1243
Comment Scm-related gene containing four mbt domains, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MNPSELRMMWMSSQYNSERITLEDAATLLGHPTVGLSVMEDLSAHQPTLDMNPMMSLMGG
DFTGQAAATAAALGVQPGTLIATNSNNLYGFAHMGGLQQQLLQQSAAAAVFQNYAEAMDN
DVENGMVGMAMEAVVDDDDQVYGQRDNNFDDNGSELEPKQEIINIDDFVMMNEDNNSYDG
TDFMTSSDKDISQSSSSCMAQMPGSLGVPGVEHDLLVPLPDGLLHHKLLGTTLVPAMGTL
NGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCSASTSSALRSQRKTRKIEPVN
RPGLVLKTPIAYRGNIDPSVIPIQKDGMAVCKRCGAIGVKHTFYTKSRRFCSMACARGEL
YSLVLNTKMEGDQATTSSPDPGAGSESADLPGDQQQSQSDIELDLHAAHIKNANYRFRIT
DQSKITQLNSFGEPMSMGGDAAANNVQMAADETIAALNGGAVGDATAPGSTEEGASTPNS
YLSAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIISIRRRMYDPTHSYDWLP
RLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEVIQPGQTPTSFWVATI
LEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDF
LVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLR
YFDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELF
KMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDA
SGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHR
IIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIY
PVGWCVLVNHKLEGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRT
IALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISEQST
TQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSATNN
KYIPRLADIDSSEPHLELVPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKD
DIMPLLGMKVGPALKISDLIAQLKCKVNPGRARSHKTNKSPFL
Download sequence
Identical sequences B7YZV6
FBpp0288419 7227.FBpp0288419 FBpp0288419 NP_001137821.1.81976 FBpp0288419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]