SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001138298.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001138298.1.87134
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-45
Family RUN domain 0.0000517
Further Details:      
 
Weak hits

Sequence:  NP_001138298.1.87134
Domain Number - Region: 245-313
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0798
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001138298.1.87134
Sequence length 400
Comment RUN domain-containing protein 3A isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKG
RAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFC
LKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDED
SWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKR
ELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKLYRRH
SFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
Download sequence
Identical sequences A0A2J8J4H9 F6RZ73 I7GJL7
O15483 ENSP00000468214 gi|221307580|ref|NP_001138298.1| ENSP00000468214 NP_001138298.1.87134 NP_001138298.1.92137 XP_008010620.1.81039 XP_011717972.1.29376 XP_011841301.1.47321 XP_011914130.1.92194 XP_014975349.1.72884 XP_016787150.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]