SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001138321.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001138321.1.86415
Domain Number 1 Region: 644-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 3 Region: 22-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000126
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 140-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 80-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 699-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000584
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  NP_001138321.1.86415
Domain Number - Region: 517-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001138321.1.86415
Sequence length 935
Comment complement component C6 precursor [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MEKTVLIQLILLSLVVGSCQGCYCEHYPWGSWSSCSKTCNYGTQTRHRQIKMDEYYNQNF
CDRLCTKQESRACNQQTCPINCQLGDFGPWSECDPCIEKQFRVRKLLRPSQFGGQACTET
LVQSRPCFPAKLCNIVDVDCKNKFQCENGRCIAKKLECNGDNDCGDNSDERYCGRKKVVC
SRKFESIPGVHLIGSGFHILSGESRGEVLGNSFNGGECRTVRRNETRKSYRVPANLEAVS
FQVIDEEDDVKSDFYRDLTPLSDGDVGSSTSSHSSQRRSGIPGLFSKKRKVQITSSSSFK
KAIEASHEKNSNFIRIHKVISVANFTMKESNLQLSDVFLKALNQLPLEYNYALYSRIFDD
FGTHYYTSGKMGGSYDILYQYSSEELKNSGLSVDESMECIRTETTRRVFFRKKKKVSTEC
ITNKMTVKHDGSILESAERSVSLVKGGRSEYAAALAWEKKGAFPGNTIFTNWLESTKDNP
VVIDFEVSSIVDLVKNMPCAVTRRRNLRRALREYAGRFDPCQCAPCPNNGRPVLSGTECL
CLCQAGTYGTNCEIRAPGYESVAVDGRWSCWSEWSSCDASFKRRRTRECNNPSPINGGKP
CKGEREEEEDCYVSVFMDNGAPCINDDEAKSELDIVVGVLETGCSRPDPPENGFIRNEKN
QYAVGEEAEIACVSGHVLIGYQFLRCLPDQTWTQQPVECQPSLCLRPPTSDSVEISPFKL
HYNIGETVKLSCRAGFVVTGQTQYTCGKDLSWFPSILRSITCEKDEQAKIRGVCNPGQKQ
VGSECVCMNPEEDCGHYSEDICVLHALSEQHVTKPSCQFSAEKCLGEQSFHFLHAGPCHS
TSSVHWAIERAKLSANSLKKVPCGYDTCYDWEECPESQMQCSCLMPYQCPREESQLHCIR
MESTGRRKRVSHCVLAAMKCAGIGLEVLEEGSCLG
Download sequence
Identical sequences B8ZX71
NP_001138321.1.86415 XP_015132835.1.86415 XP_015132837.1.86415 XP_015132838.1.86415 ENSGALP00000023910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]