SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001138886.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001138886.1.92137
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-19
Family GDI-like N domain 0.00000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001138886.1.92137
Sequence length 110
Comment rab proteins geranylgeranyltransferase component A 1 isoform b [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYARSTLLL
Download sequence
Identical sequences A0A2I2YIZ1
gi|224028271|ref|NP_001138886.1| NP_001138886.1.87134 NP_001138886.1.92137 ENSP00000484306 ENSP00000362228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]