SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001152990.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001152990.1.92730
Domain Number 1 Region: 190-298
Classification Level Classification E-value
Superfamily Immunoglobulin 3e-16
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000565
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000115
Family Ovomucoid domain III-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001152990.1.92730
Sequence length 313
Comment insulin-like growth factor-binding protein 7 isoform 1 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MMERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCC
PVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVC
GSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGSLIWDTQPAQRSHNPQVENRC
FRDKHSREQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELL
PGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDAL
HEIPLKKGEGAQL
Download sequence
Identical sequences E9Q5D9
ENSMUSP00000128318 ENSMUSP00000128318 NP_001152990.1.92730 ENSMUSP00000128318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]