SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001153320.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001153320.1.23681
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-38
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001153320.1.23681
Sequence length 223
Comment serine/threonine/tyrosine-interacting protein [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGTTGSLKRTHEEEDDFGTMQVATAQNG
Download sequence
Identical sequences A0A2I3H8M7 G3QHG7 Q5RDP3
ENSGGOP00000001796 ENSNLEP00000015284 ENSNLEP00000015284 ENSGGOP00000001796 NP_001153320.1.23681 XP_012359902.1.23891 XP_018865659.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]