SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001153439.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001153439.1.92730
Domain Number 1 Region: 15-290
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-81
Family Ras GEF 0.0000406
Further Details:      
 
Domain Number 2 Region: 439-557
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000219
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001153439.1.92730
Sequence length 564
Comment ras-specific guanine nucleotide-releasing factor RalGPS2 isoform b [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASREDL
AGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMN
TAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA
FESSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCGTQLFYYAAK
SLKATERKHFKSTSNKNVSVVGWMVMMADDPEHPDLFLLTDSEKGNSYKFQAGSRMNAML
WFKHLSAACQSNKQQVPTNLMTFE
Download sequence
Identical sequences NP_001153439.1.92730 ENSMUSP00000027886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]