SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001155294.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001155294.1.92730
Domain Number 1 Region: 91-223
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-45
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001155294.1.92730
Sequence length 230
Comment regulator of G-protein signaling 17 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MGFFSKKLLLRWQLGSEAADMRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSC
LTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFRE
FLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVIN
RSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES
Download sequence
Identical sequences G5E8E0
ENSMUSP00000113519 NP_001155294.1.92730 ENSMUSP00000065825 ENSMUSP00000065825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]