SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001156593.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001156593.1.92137
Domain Number 1 Region: 63-232
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.73e-22
Family The homologous-pairing domain of Rad52 recombinase 0.031
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000337
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001156593.1.92137
Sequence length 251
Comment RAD52 motif-containing protein 1 isoform 4 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
YFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLV
EEPMDKVEEESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSL
EEEEFRLPELD
Download sequence
Identical sequences NP_001156593.1.87134 NP_001156593.1.92137 ENSP00000391290 ENSP00000474637 gi|253314445|ref|NP_001156593.1| ENSP00000478915 ENSP00000483566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]