SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001157784.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001157784.1.92730
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0044
Further Details:      
 
Domain Number 2 Region: 312-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000518
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001157784.1.92730
Sequence length 537
Comment flavin-containing monooxygenase 12 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MGVKRIAVIGAGVSGLGAIKCCLEEGLEPTCFEKKSDIGGLWKYEEIPKSGNLGIYKSLT
CNTSKEMTAFSDYPIPDHYPNYMHHSKMMEYLRMYARHFGLMKHIQFQTNVCNIKKRPDF
SSSGQWDVVVETEEMQKTYIFDGIMVCSGHYTEKYFPLQDFEGISKFQGSYLHTWEYKHP
DNFVGKRVAVIGLGNSGADVAGEISRVADQVFLSTRQGAWIWNRVWDHGEPMDTTVFTRY
NRAVQKICPRYIINRQMEKKLNGRFNHANYGLLPTHRILEQRTVLSDDLPNRIIIGKVKI
KPNVKEFTSTSAIFEDGTKENIDVVIFATGYKLSFPFLSDDSGVLDNQYSMFKYVFPPEL
EKPTLAFIGILQPAGAILPTSELQSRWVVHVFKGIKKLPSRRAMIADINRKNHQIMAKGS
KKILQDHRRVTFVDYMDEIASEIGVKPNLLSLLLWDTKLAKEVFCGPCTSYQYRLQGPGK
WDGARAAILTQRERMLKPLRTRVVKQSHLSHLSWVKSACVVVFFFISVVVIMHITSH
Download sequence
Identical sequences G3X946
ENSMUSP00000039839 10090.ENSMUSP00000039839 NP_001157784.1.92730 ENSMUSP00000039839 ENSMUSP00000039839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]