SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001157854.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001157854.1.87134
Domain Number 1 Region: 199-275
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.19e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 101-180
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.18e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 
Domain Number 3 Region: 35-96
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000581
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Weak hits

Sequence:  NP_001157854.1.87134
Domain Number - Region: 391-455
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00546
Family Double-stranded RNA-binding domain (dsRBD) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001157854.1.87134
Sequence length 504
Comment double-stranded RNA-binding protein Staufen homolog 2 isoform c [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTR
QAARHNAAMKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVS
FEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKP
KLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQV
KVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEP
TNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATI
ARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQVHYCDRQSGKECVT
CLTLAPVQMTFHAIGSSIEASHDQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLR
EKADNNQAPPGSIAQDCKKSNSAV
Download sequence
Identical sequences A0A0A0MTC6
gi|256418999|ref|NP_001157854.1| ENSP00000429173 ENSP00000429173 NP_001157854.1.87134 NP_001157854.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]