SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001159700.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001159700.1.45394
Domain Number 1 Region: 43-117
Classification Level Classification E-value
Superfamily SH3-domain 0.00000132
Family SH3-domain 0.0031
Further Details:      
 
Weak hits

Sequence:  NP_001159700.1.45394
Domain Number - Region: 624-689,785-1017
Classification Level Classification E-value
Superfamily ARM repeat 0.000461
Family MIF4G domain-like 0.039
Further Details:      
 
Domain Number - Region: 466-539
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0114
Family PLC-like (P variant) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001159700.1.45394
Sequence length 1977
Comment dedicator of cytokinesis protein 4 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MFSPPARELRLCFLDGGEECKAIILSSVLFCKELKPPDLLAGFRGTVQHGLPLEIGDTVQ
ILEKCEGWYRGFVLKNPNAKGIFPCCYIHLKNAHIKNKGQFETVVPSEDSVITEMTSTLR
DWGAMWKQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGN
EQLGLDLVPRREFSMVDPDDISVTELYRLMEHRHRKKETPAPVSTHHLFVHLKSLMSSNL
GEELEVFFFIYDSRENRPLSERFFVKLNKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYI
VVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACNTESDWS
QIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDV
IMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEY
HTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDKGEKKLFGFSFVPLMQED
GRTLPDGTHELIVHKCEENANLQDCSRYLKLPFSKSNLPGNNQTVKGTKESLWITSFLCS
TKLTQNGDMLDLLKWRAHPERISDSLSKLKEIDGSEIVKFLQDTLDTLFGILDESSQRYA
LKVFDCLVHIINLLQDSKFQHFKPVMDTYIESHFAGALSYRDLIKVLKWYVDRIIDADRQ
EHIQQVLKATEYIFKYIVQSRRLFALATGGQNEEEFRCCMHELFMSIRFFLSQENKSMRP
ITHTQAVFLQSFPAVYNELLKLFTVREVATFVRETLGSLPTASQPDCPLEAVKLHCIAKT
VDSQLYTNPDSRCVLLPVVLRLLQAHMQEQRDLVMCAHILTCMLSLLKKDDTDSSSSEEV
DLIVESVLAVLLRTILEVANRPQPAGPTLRPQVQDVTGEFVSCLLALLRHMKDKHYQQLL
QRFTSKEDLRDFLLHIFTVFRILIRPEMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFL
SEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNL
GEHKLNFIPAMIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLD
SLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVD
GKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSER
PLREFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKM
RMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNE
FPHAIAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWR
FRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEV
IENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFFVKDYIMNHPE
DGDKIGRLRELMFEQAHILEFGLTVHEKFVPQDMRPLHKKLVDQFHLMKSSLGIQEFPAY
VRASPIHFTNGSPRVGRNSAPNIMSPDGGARVVSRRSPLSYPAVNRYSSSSLSSQASNEV
SNITGHSESSDEVFNMQPSPSTSSLSSNHSASPNVSSSAPSSARGSPQLSDKHKHPRENC
LSPRDRPCSAVYPNPMEPTQRPVPHPAGDSSLPRSDPNISSPDKVVKPAPSSWSLDMPLS
EFNGKCPPVPPRPPYSGSPARTTRSQSPVSTSRSPQKTSVPPFTPSPTECQSTGLVSNSP
VLSGSYSSGISSLSRCSVSEASGTENTPTDHVLPNSASSGSDELIRRENKTPPPYSIHER
NNPRRQVPLPPSLSLPPNVDAPPIPPKPHQIRRQDTEPRRPEQFPRPRPIPRKVSQL
Download sequence
Identical sequences E9QJL8
ENSDARP00000036828 NP_001159700.1.45394 ENSDARP00000036828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]