SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001159996.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001159996.1.76553
Domain Number 1 Region: 771-951
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.26e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 926-1044
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 160-192,228-374
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-31
Family Phosphotyrosine-binding domain (PTB) 0.0055
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-20
Family Phosphotyrosine-binding domain (PTB) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001159996.1.76553
Sequence length 1165
Comment TBC1 domain family member 1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEPITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
TKPVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQRVHKLIHNSHDPSYFACLIKN
DAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VAVAHRKAPPALIDECIEGFSHVSGGFSSDQSRSALQPPGDGERGPRPMRKSFSQPGLRS
LAFRKEFQDAGLRSSSFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLI
SPDTKKIALQKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDEI
MMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTTLTN
QEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKVHIHIGEIKQTSQIAAENIGSE
LPSSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSVSSMFSNTSK
EPSGYEKEALPISESCFRLLGSSDDLSSDSESQLTEEPALLSPKQGFRRRANTLSHVPVE
CQEPPQLVRGSPGVSQRKLVRYHSVSTETPHERKDFESKADHISDASRTPVKTRRHSWRQ
QIFLRVATPQKACESPKRYEDYSELGELPPRSPLEPVCEDGPFGPVPEEKKRTSHELREL
WQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKILSTPGR
SKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQYHLKHPFPCKQQPKDTPYKELLKQLTS
QQHAILIDLGRTFPTHPYYSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLH
MGEEEAFNMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPS
LYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIV
DFIKSTLPNLGLVQMEKTISQVFETDISKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKL
EKTNSSLRKQNLDLLEQLQVANGRIQSLEATVEKLLTSESKLKQATLALELERSALLQTV
EQLRRQTAELGSQESDPTLPKPSGD
Download sequence
Identical sequences O97790
ENSBTAP00000018206 9913.ENSBTAP00000018206 NP_001159996.1.59421 NP_001159996.1.76553 XP_005207895.1.76553 ENSBTAP00000018206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]