SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001160069.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001160069.1.92730
Domain Number 1 Region: 487-817
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-53
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 989-1105
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-20
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  NP_001160069.1.92730
Domain Number - Region: 288-340
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00541
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001160069.1.92730
Sequence length 1123
Comment diacylglycerol kinase zeta isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
METFFRKHFQRKARGPGERQRRSSGVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCF
PSCGVGTRGASRRRSSTAPPTCNPRFMVDVVPTLQPVTVGAQLLGAPLLLAGLTSMKEEE
EEEGVQEGNETAEATSDARPGTRTTPFSHQGTWPLLPMPRCLRRASSHLLPADVECGHTL
WGLHGHYRRLSQRWPSGQHPGLGGRSPRASGAAACPMIPARVRPLSRRRQVALRRKSAGP
QPWSTLLMKAITKSGLQHLAPPPPTPGAPCGESEEQIQSTVDWSESAVYGEHIWFETNVS
GDFCYVGEQHCVAKMLPKSAPRKKCAACKIVVHTQCIKQLEKINFRCKPSFRESGSRNVR
EPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMMQQ
IEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFII
RPTPSPLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHN
LRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKIL
SHVEEGNVVQLDRWDLRAEPNPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHE
SREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCI
VFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCR
EVLLTTAKAIPVQVDGEPCKLSASRIRIALRNQATMVQKAKRRSTAPLHSDQQPVPEQLR
IQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQREPDGAGAKS
PMCHQLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPT
PTSPLPASPCSPTPGSMQGDTALPQGEELIEAAKRNDCCKLQELHRAGGDLMHRDQKSRT
LLHHAVSTGSKEVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLM
KTDLQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences A2AHK0
NP_001160069.1.92730 ENSMUSP00000118684 ENSMUSP00000106934 ENSMUSP00000106934 10090.ENSMUSP00000106934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]