SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001161302.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001161302.1.92137
Domain Number 1 Region: 44-139
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.75e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001161302.1.92137
Sequence length 193
Comment transmembrane emp24 domain-containing protein 5 isoform 2 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEI
EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVI
FFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILDPIIKIASDVQIRLHLGIHQQHQ
VQTKQKWAHTNSA
Download sequence
Identical sequences NP_001161302.1.87134 NP_001161302.1.92137 ENSP00000418992 gi|282165817|ref|NP_001161302.1| ENSP00000418992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]