SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001162644.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001162644.1.81976
Domain Number 1 Region: 1260-1334
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.86e-17
Family SAM (sterile alpha motif) domain 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001162644.1.81976
Sequence length 1346
Comment polyhomeotic proximal, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEVQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAATG
GVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQML
TTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSMAAA
AQQQQLTQQQQQFNQQQQQQLTQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSAVQA
ATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNAGQA
QQMQIPWFLQNAAGLQPFGPNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCNVTQ
TPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPV
MPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHL
TTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQ
KQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQ
AQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQ
QQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQLSS
VPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSSTPLV
TSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTPTTNPILAMTSMMNAT
VGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPI
GSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSK
QSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVST
ASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEANEPFP
VTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYC
SPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSES
FPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVN
GTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGP
ALKIVAKVESIKEVPPPGEAKDPGAQ
Download sequence
Identical sequences Q5U0W8
FBpp0290730 FBpp0290730 NP_001162644.1.81976 NP_001284802.1.81976 NP_001284803.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]