SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001162933.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001162933.1.81976
Domain Number 1 Region: 28-189
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-46
Family Dual specificity phosphatase-like 0.00000144
Further Details:      
 
Domain Number 2 Region: 180-335
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.85e-32
Family PLC-like (P variant) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001162933.1.81976
Sequence length 514
Comment phosphatase and tensin homolog, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MANTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLED
VFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWL
KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQR
RYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKPDRL
KTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKSPDKIICHFWLNTFFVRNYSPCESDGTV
NKYIHTLSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFE
RSDYDSLSPNCYAEKKVLTAIVNDNTTKSQTIETLDHKDIVTKIQYDTSTNSKNTSTACK
RKQPNSKTLLPSLNDSTKEEIKRNHIFNQPSIKKTDLIKWQNSEVHITSDTRSINENKNI
NYNSYITCKQSSPKFNCGTEDGEEDWESGESTYL
Download sequence
Identical sequences Q7KMQ6
FBpp0088839 FBpp0088843 FBpp0289789 FBpp0290736 NP_001162933.1.81976 NP_477422.2.81976 NP_477423.1.81976 NP_599149.1.81976 FBpp0088839 7227.FBpp0088839 FBpp0088839 FBpp0088843 FBpp0289789 FBpp0290736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]