SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001162966.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001162966.2.81976
Domain Number 1 Region: 18-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-51
Family Hypothetical protein AT3g04780/F7O18 27 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001162966.2.81976
Sequence length 211
Comment CG6153, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEK
RQDLSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDAR
AKPDQEFQLTRDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAH
YHGVTICNYESRANAADHKEKAFDGVGRAIQ
Download sequence
Identical sequences E1JHG8 Q9VK68
FBpp0079975 FBpp0079975 NP_001162966.2.81976 NP_609580.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]