SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001162967.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001162967.1.81976
Domain Number 1 Region: 1134-1212
Classification Level Classification E-value
Superfamily RING/U-box 1.68e-24
Family U-box 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001162967.1.81976
Sequence length 1217
Comment CG9934, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPEEEPPQKPMEEEEDDDQEQDQDQDHEQDQHEQDQQPQLAQGEIPGQQLPEQPNPDVQP
QQPAESVVVTELSAEEMRARRLRTLAARSGIQCALAPLTTTPRKPTNVSGESRLVREATP
GEKEVSLPTSAPAWRELSGKPDMDVEMKSVVSTPMQDVDMTTALSLPTAEATKRSVLQSC
KISAGNAELSIETVVGPKKSADEQNEQLLSRLLNATWNEYGSGSIICAQSASFLEQQPHR
RFDFECIVANVLMEAVLKIYNGELIEGDGVSVKADDKEFSSAKKIKSDDTEVQEILANAV
ATGGATASGETAAAAAGASGPIEATSSEAAGTCVAPPVLSIVATTKHHVLLYLIRCYQNY
QTECSRKTPLTQPALQLAFEQVMRMTVLVLTDRIYQNLNGHMDQSALLDLMYMAKVSEPF
LIDLIAHTHQDREAFDTIFSQVLRGLFAGMQRNICTSKISVQQIEWLSKLVVIKVGSVRP
IADLVSRQPNFLPPICTKISGREIVKCSFLGPFLSVSLFAEENIKFAEFTTKNKLEDASS
SRLRWELHSMRTNMHVVFHSLCVNASSRPKTLEYIASILRHNDRRVQFASDEKLLARDGF
MINLMSVLQQLSVKIKLDRIEPNFHYYKNSLVNIEQDTKIRYSEEEYRNFLARDFSQPVE
NTNFQTQCWFLTLQAHHLGYLPAIQRYRQKVRAIKELQKLIDELDRTKSHWMNSRYANRN
NQFKERWEKQLRKLNRSKTCCEITLLDPGLLQRCTEFYSTVCEFMLYQFEGRPIEGPFIS
KLPVQQLLPTDAFSALPEWYIDDIAEFILFTMQHANMDIRQGIDHSIITWLLTCVCASHL
IKNPYVTAKLVEVMFVFSLKPANSVNAAMWNHELAQNALVSSLMRFYVDVETTGQSTEFY
DKFTIRYHISHLFKSMWENPIHRQAVICESRVGNQFVKFVNMLMNDTTFLLDECLENLKR
IHQTQQLLSDKANLSKMSAEQQQSRLTQLATDERQCRSYLTLARETVDLFHYLTSDIKEP
FMRDELVDRLSSMLNFNLKQLAGPKCNDLKVKNPAKYGWEPRSLLAQIFDIYLHLDCDRF
AEALAADERSFDVQICNEAASRIKRLALRSAVEVERFKALTQRAHEIYVTNLQTEDECAD
APDEFKDPLMDTLMSDPVVLPSGTVMDRAIITRHLLNSCTDPFNRQPLTEDMLVANIELK
QRIDAWRKEQRGKRNNC
Download sequence
Identical sequences Q9VK44
7227.FBpp0080009 FBpp0080009 FBpp0290465 FBpp0080009 FBpp0290465 NP_001162967.1.81976 NP_609597.1.81976 FBpp0080009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]